HPA007856

CCAR1 antibody from Atlas Antibodies
CARP-1, CARP1, FLJ10590
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007856
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007856, RRID:AB_1078415
Product name
Anti-CCAR1
Provider product page
Atlas Antibodies - HPA007856
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAE
VEQKLQLLEEKTDEDEKTILNLENSNKSLSGELRE
VKKDLSQLQENLKISENMNLQFENQMNKTIRNLST
VMDEIHTVLKKDNVKNED
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -