HPA007856

CCAR1 antibody from Sigma-Aldrich
CARP-1, CARP1, FLJ10590
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007856
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007856, RRID:AB_1078415
Product name
Anti-CCAR1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007856
Antibody type
Polyclonal
Antigen
Cell division cycle and apoptosis regulator protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAE
VEQKLQLLEEKTDEDEKTILNLENSNKSLSGELRE
VKKDLSQLQENLKISENMNLQFENQMNKTIRNLST
VMDEIHTVLKKDNVKNED
Storage
-20C
Provider Type Product Number
- No reagents -