HPA008160

NGEF antibody from Sigma-Aldrich
ARHGEF27
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008160
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008160, RRID:AB_1854450
Product name
Anti-NGEF antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008160
Antibody type
Polyclonal
Antigen
Ephexin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
METRESEDLEKTRRKSASDQWNTDNEPAKVKPELL
PEKEETSQADQDIQDKEPHCHIPIKRNSIFNRSIR
RKSKAKARDNPERNASCLADSQDNGKSVNEPLTLN
IPWSRTPPCRTAMQTDPGAQEMSESSST
Storage
-20C
Provider Type Product Number
- No reagents -