HPA000820

ASPHD2 antibody from Sigma-Aldrich
FLJ39838
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000820
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000820, RRID:AB_1078231
Product name
Anti-ASPHD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000820
Antibody type
Polyclonal
Antigen
Aspartate-beta-hydroxylase domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HKGIREQGRYLNSRPSIQKPEVFFLPDLPTTPYFS
RDAQKHDVEVLERNFQTILCEFETLYKAFSNCSLP
QGWKMNSTPSGEWFTFYLVNQGVCVPRNCRKCPRT
YRLLGSLRTCIGNNVFGNACISVLSPGTVITEHYG
PTNIRIRCHLGLKTPNGCELVVGGEPQCWAEGRCL
LFDDSFL
Storage
-20C
Provider Type Product Number
- No reagents -