HPA007859

FNDC3B antibody from Sigma-Aldrich
DKFZp762K137, FAD104, FLJ23399, PRO4979, YVTM2421
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007859
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007859, RRID:AB_1078900
Product name
Anti-FNDC3B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007859
Antibody type
Polyclonal
Antigen
fibronectin type III domain containing 3B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECY
PPSYPSAMSPTHHLPPYLTHHPHFIHNSHTAYYPP
VTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMST
YITREDQYSK
Storage
-20C
Provider Type Product Number
- No reagents -