Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00056925-M01 - Provider product page
- Provider
- Abnova Corporation
- Product name
- LXN monoclonal antibody (M01), clone 8H5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LXN.
- Antigen sequence
NSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLH
NIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQ
LE- Isotype
- IgG
- Antibody clone number
- 8H5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- LXN monoclonal antibody (M01), clone 8H5. Western Blot analysis of LXN expression in MCF-7.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of LXN expression in transfected 293T cell line by LXN monoclonal antibody (M01), clone 8H5.Lane 1: LXN transfected lysate (Predicted MW: 25.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged LXN is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol