HPA014179

LXN antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014179
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014179, RRID:AB_1853404
Product name
Anti-LXN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014179
Antibody type
Polyclonal
Antigen
Latexin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQ
KVKQASMEDIPGRGHKYHLKFAVEEIIQKQVKVNC
TAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNT
F
Storage
-20C
Provider Type Product Number
- No reagents -