Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA014179 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA014179, RRID:AB_1853404
- Product name
- Anti-LXN
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQ
KVKQASMEDIPGRGHKYHLKFAVEEIIQKQVKVNC
TAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNT
F- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The hematopoietic stem cell regulatory gene latexin has tumor-suppressive properties in malignant melanoma.
Muthusamy V, Premi S, Soper C, Platt J, Bosenberg M
The Journal of investigative dermatology 2013 Jul;133(7):1827-33
The Journal of investigative dermatology 2013 Jul;133(7):1827-33
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LXN antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong cytoplasmic and nuclear positivity in glandular cells.
- Sample type
- HUMAN