HPA013132

OGN antibody from Sigma-Aldrich
mimecan, OIF, SLRR3A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013132
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013132, RRID:AB_1854825
Product name
Anti-OGN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013132
Antibody type
Polyclonal
Antigen
Mimecan precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKS
RGIKANAFKKLNNLTFLYLDHNALESVPLNLPESL
RVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIR
LEGNPIVLGKHPNSFI
Storage
-20C
Provider Type Product Number
- No reagents -