HPA009142

COMMD9 antibody from Sigma-Aldrich
FLJ31106, HSPC166
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009142
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009142, RRID:AB_1847105
Product name
Anti-COMMD9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009142
Antibody type
Polyclonal
Antigen
COMM domain-containing protein 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRD
LSSAEAILALFPENFHQNLKNLLTKIILEHVSTWR
TEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVP
TCLLQMKIQEDPSLCGDKPSISAVTV
Storage
-20C
Provider Type Product Number
- No reagents -