Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA070695 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA070695, RRID:AB_2686297
- Product name
- Anti-COL12A1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TGYKVILTPMTAGSRQHALSVGPQTTTLSVRDLSA
DTEYQISVSAMKGMTSSEPISIMEKTQPMKVQVEC
SR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Exogenous supply of Hsp47 triggers fibrillar collagen deposition in skin cell cultures in vitro
Khan E, Sankaran S, Llontop L, del Campo A
BMC Molecular and Cell Biology 2020;21(1)
BMC Molecular and Cell Biology 2020;21(1)
No comments: Submit comment
No validations: Submit validation data