HPA009143

COL12A1 antibody from Atlas Antibodies
COL12A1L
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009143
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009143, RRID:AB_1847095
Product name
Anti-COL12A1
Provider product page
Atlas Antibodies - HPA009143
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGT
PLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGA
PGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQG
LKEGTQYALSVTALYASGAG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -