HPA009143

COL12A1 antibody from Sigma-Aldrich
COL12A1L
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009143
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009143, RRID:AB_1847095
Product name
Anti-COL12A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009143
Antibody type
Polyclonal
Antigen
Collagen alpha-1(XII) chain precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGT
PLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGA
PGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQG
LKEGTQYALSVTALYASGAG
Storage
-20C
Provider Type Product Number
- No reagents -