HPA015483

TXNDC15 antibody from Sigma-Aldrich
2310047H23Rik, C5orf14, FLJ22625
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015483
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015483, RRID:AB_1845722
Product name
Anti-C5orf14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015483
Antibody type
Polyclonal
Antigen
Thioredoxin domain-containing protein 15 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TGLENFTLKILNMSQDLMDFLNPNGSDCTLVLFYT
PWCRFSASLAPHFNSLPRAFPALHFLALDASQHSS
LSTRFGTVAVPNILLFQGAKPMARFNHTDRTLETL
KIFIFNQTGIEAKKNVVVTQADQI
Storage
-20C
Provider Type Product Number
- No reagents -