Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA010022 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA010022, RRID:AB_1844723
- Product name
- Anti-ALDH1A2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEG
AKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEE
IFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTN
DINKALTVSSAMQAGTV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Identification of active retinaldehyde dehydrogenase isoforms in the postnatal human eye.
Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell carcinoma
Evaluation of protein biomarkers of prostate cancer aggressiveness.
HPV-related methylation signature predicts survival in oropharyngeal squamous cell carcinomas.
Harper AR, Wiechmann AF, Moiseyev G, Ma JX, Summers JA
PloS one 2015;10(3):e0122008
PloS one 2015;10(3):e0122008
Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell carcinoma
Seidensaal K, Nollert A, Feige A, Muller M, Fleming T, Gunkel N, Zaoui K, Grabe N, Weichert W, Weber K, Plinkert P, Simon C, Hess J
Molecular Cancer 2015 December;14(1)
Molecular Cancer 2015 December;14(1)
Evaluation of protein biomarkers of prostate cancer aggressiveness.
Rizzardi AE, Rosener NK, Koopmeiners JS, Isaksson Vogel R, Metzger GJ, Forster CL, Marston LO, Tiffany JR, McCarthy JB, Turley EA, Warlick CA, Henriksen JC, Schmechel SC
BMC cancer 2014 Apr 5;14:244
BMC cancer 2014 Apr 5;14:244
HPV-related methylation signature predicts survival in oropharyngeal squamous cell carcinomas.
Kostareli E, Holzinger D, Bogatyrova O, Hielscher T, Wichmann G, Keck M, Lahrmann B, Grabe N, Flechtenmacher C, Schmidt CR, Seiwert T, Dyckhoff G, Dietz A, Höfler D, Pawlita M, Benner A, Bosch FX, Plinkert P, Plass C, Weichenhan D, Hess J
The Journal of clinical investigation 2013 Jun;123(6):2488-501
The Journal of clinical investigation 2013 Jun;123(6):2488-501
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human endometrium and skin tissues using HPA010022 antibody. Corresponding ALDH1A2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human parathyroid gland shows strong cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows moderate to strong cytoplasmic positivity in cells in endometrial stroma.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows weak cytoplasmic positivity in a subset of keratinocytes.
- Sample type
- HUMAN