HPA011912

PDLIM4 antibody from Sigma-Aldrich
RIL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011912
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011912, RRID:AB_1856277
Product name
Anti-PDLIM4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011912
Antibody type
Polyclonal
Antigen
PDZ and LIM domain protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HSVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSK
AALAALCPGDLIQAINGESTELMTHLEAQNRIKGC
HDHLTLSVSRPEGRSWPSAPDDSKAQAHRIHIDPE
Storage
-20C
Provider Type Product Number
- No reagents -