Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00255488-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00255488-M02, RRID:AB_606425
- Product name
- IBRDC2 monoclonal antibody (M02), clone 4F1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant IBRDC2.
- Antigen sequence
MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLC
EQSLDKMTTLQECQCIFCTACLKQYMQLAIREGCG
SPITCPDMVCLNHGTLQEAEIACLVPVDQF- Isotype
- IgG
- Antibody clone number
- 4F1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- IBRDC2 monoclonal antibody (M02), clone 4F1 Western Blot analysis of IBRDC2 expression in IMR-32 ( Cat # L008V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RNF144B expression in transfected 293T cell line by IBRDC2 monoclonal antibody (M02), clone 4F1.Lane 1: RNF144B transfected lysate(33.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to IBRDC2 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to IBRDC2 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 1.2 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol