HPA010516

RNF144B antibody from Sigma-Aldrich
bA528A10.3, IBRDC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010516
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010516, RRID:AB_1851375
Product name
Anti-IBRDC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010516
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase RNF144B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EWKSSCPVCQQPGLAVSAREATEKPGDGGTQVCCQ
GLRRLKNAEDRLMGSAGRLHYLAMTAENPTPGDLA
PAPLITCKLCLCEQSLDKMTTLQECQCIFCTAC
Storage
-20C
Provider Type Product Number
- No reagents -