HPA014288

ARHGAP24 antibody from Sigma-Aldrich
DKFZP564B1162, FilGAP, FLJ33877
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014288
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014288, RRID:AB_1844994
Product name
Anti-ARHGAP24 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014288
Antibody type
Polyclonal
Antigen
Rho GTPase-activating protein 24 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ILNSDTLGNPTNVRNMSWLPNGYVTLRDNKQKEQA
GELGQHNRLSTYDNVHQQFSMMNLDDKQSIDSATW
STSSCEISLPENSNSCRSSTTTCPEQDFFGGNFED
PVLDGPPQDDLSHPRDYESKSD
Storage
-20C
Provider Type Product Number
- No reagents -