HPA010554

TPBG antibody from Atlas Antibodies
5T4, 5T4-AG
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010554
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010554, RRID:AB_1858206
Product name
Anti-TPBG
Provider product page
Atlas Antibodies - HPA010554
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAE
LQGLPHIRVFLDNNPWVCDCHMADMVTWLKETEVV
QGKDRLTCAYPEKMRNRVLLELNSADLDCDPILP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -