HPA010554

TPBG antibody from Sigma-Aldrich
5T4, 5T4-AG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010554
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010554, RRID:AB_1858206
Product name
Anti-TPBG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010554
Antibody type
Polyclonal
Antigen
Trophoblast glycoprotein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAE
LQGLPHIRVFLDNNPWVCDCHMADMVTWLKETEVV
QGKDRLTCAYPEKMRNRVLLELNSADLDCDPILP
Storage
-20C
Provider Type Product Number
- No reagents -