H00009589-M01

WTAP antibody from Abnova Corporation
KIAA0105, MGC3925, Mum2

Antibody data

Product number
H00009589-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009589-M01, RRID:AB_1137536
Product name
WTAP monoclonal antibody (M01), clone 1B11
Provider product page
Abnova Corporation - H00009589-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant WTAP.
Antigen sequence
ARRENILVMRLATKEQEMQECTTQIQYLKQVQQPS
VAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQ
NELSAWKFTPDR
Isotype
IgG
Antibody clone number
1B11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -