HPA010550

WTAP antibody from Sigma-Aldrich
KIAA0105, MGC3925, Mum2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010550
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010550, RRID:AB_1858866
Product name
Anti-WTAP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010550
Antibody type
Polyclonal
Antigen
Pre-mRNA-splicing regulator WTAP recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DEEVEGMQSTILVLQQQLKETRQQLAQYQQQQSQA
SAPSTSRTTASEPVEQSEATSKDCSRLTNGPSNGS
SSRQRTSGSGFHREGNTTEDDFPSSPGNGNKSSNS
SEERTGRGGSGYVNQLSAGYESVDSPTGSENSLTH
QSND
Storage
-20C
Provider Type Product Number
- No reagents -