PAB28225

NAXD antibody from Abnova Corporation
CARKD, FLJ10769, LP3298

Antibody data

Product number
PAB28225
Provider
Abnova Corporation
Product name
CARKD polyclonal antibody
Provider product page
Abnova Corporation - PAB28225
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant CARKD.
Antigen sequence
PNAVHEVEKWLPRLHALVVGPGLGRDDALLRNVQG
ILEVSKARDIPVVIDADGLWLVAQQPALIHGYRKA
VLTPNHVEFSRLYDAVLRGPMDSDDSHGSVLRLSQ
ALGNVTVVQ
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -