HPA010551

NAXD antibody from Atlas Antibodies
CARKD, FLJ10769, LP3298
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010551
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010551, RRID:AB_1848669
Product name
Anti-NAXD
Provider product page
Atlas Antibodies - HPA010551
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PNAVHEVEKWLPRLHALVVGPGLGRDDALLRNVQG
ILEVSKARDIPVVIDADGLWLVAQQPALIHGYRKA
VLTPNHVEFSRLYDAVLRGPMDSDDSHGSVLRLSQ
ALGNVTVVQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -