Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405914 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-1-Acylglycerol-3-Phosphate O-Acyltransferase 5 (Lysophosphatidic Acid Acyltransferase, Epsilon) (AGPAT5) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-AGPAT5 antibody: synthetic peptide directed towards the N terminal of human AGPAT5
- Description
- Affinity Purified
- Reactivity
- Human, Rat, Bovine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
RLLSAFLPARFYQALDDRLYCVYQSMVLFFFENYT
GVQIL LYGDLPKNKE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Functional characterization of human 1-acylglycerol-3-phosphate acyltransferase isoform 8: cloning, tissue distribution, gene structure, and enzymatic activity.
An antimony trichloride reagent suitable for the detection and estimation of nonketonic steroids.
Agarwal AK, Barnes RI, Garg A
Archives of biochemistry and biophysics 2006 May 15;449(1-2):64-76
Archives of biochemistry and biophysics 2006 May 15;449(1-2):64-76
An antimony trichloride reagent suitable for the detection and estimation of nonketonic steroids.
ROSENKRANTZ H
Archives of biochemistry and biophysics 1953 May;44(1):1-8
Archives of biochemistry and biophysics 1953 May;44(1):1-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting