HPA010950

AGPAT5 antibody from Sigma-Aldrich
FLJ11210, LPAAT-e, LPAAT-epsilon
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010950
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010950, RRID:AB_1844648
Product name
Anti-AGPAT5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010950
Antibody type
Polyclonal
Antigen
1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ANHQSTVDWIVADILAIRQNALGHVRYVLKEGLKW
LPLYGCYFAQHGGIYVKRSAKFNEKEMRNKLQSYV
DAGTPMYLVIFPEGTRYNPEQTKVLSASQAFAAQR
GLAVLKHVLTPRIK
Storage
-20C
Provider Type Product Number
- No reagents -