HPA017055

SAMSN1 antibody from MilliporeSigma / Merck KGaA
HACS1, NASH1, SASH2, SH3D6B, SLy2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017055
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA017055, RRID:AB_1856560
Product name
Anti-SAMSN1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA017055
Antibody type
Polyclonal
Antigen
SAM domain-containing protein SAMSN-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLNGYETLEDLKDIKESHLIELNIENPDDRRRLLS
AAENFLEEEIIQEQENEPEPLSLSSDISLNKSQLD
DCPRDSGCYISSGNSDNGKEDLESENLSDMVHKII
ITEPS
Storage
-20C
Provider Type Product Number
- No reagents -