Antibody data
- Product number
- HPA009678
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA009678, RRID:AB_2112580
- Product name
- Anti-GRAMD3
- Provider product page
- Atlas Antibodies - HPA009678
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GKRESKLGSAHSEAENGVEEKKKACRSPTAQSPTP
SVEADSPDQKKIISLWSKSSFDGASLASDKNDCKT
ESKNDPKTERKKSSSSSQYKANMHFHKLFLSVPTE
EPLKQSFTCALQKEILYQGKLFVSENWI
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in human cell line CAPAN-2.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human small intestine shows cytoplasmic positivity in glandular cells.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human fallopian tube shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis shows low expression as expected.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human fallopian tube and testis tissues using Anti-GRAMD3 antibody. Corresponding GRAMD3 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more