Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA009292 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA009292, RRID:AB_1846225
- Product name
- Anti-CD109
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VVSGNKRLKELSYMVVSRGQLVAVGKQNSTMFSLT
PENSWTPKACVIVYYIEDDGEIISDVLKIPVQLVF
KNKIKLYWSKVKAEPSEKVSLRISVTQPDSIVGIV
AVDKSVNLMNASNDITMENVVHEL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Prognostic Significance of CD109 Expression in Patients with Ovarian Epithelial Cancer
CD109 expression is upregulated in penile squamous cell carcinoma
CD109 is a novel marker for squamous cell/adenosquamous carcinomas of the gallbladder
Kim S, Choi K, Hwang C, Lee H, Lee J, Shin D, Kim J, Sol M, Kim J, Kim K, Suh D, Kwon B
Journal of Pathology and Translational Medicine 2019;53(4):244-252
Journal of Pathology and Translational Medicine 2019;53(4):244-252
CD109 expression is upregulated in penile squamous cell carcinoma
Dong F, Wang J, Xu Y, Cheng Z, Chen X, Wang Y, Liu J
Oncology Letters 2017
Oncology Letters 2017
CD109 is a novel marker for squamous cell/adenosquamous carcinomas of the gallbladder
Dong F, Lu C, Chen X, Guo Y, Liu J
Diagnostic Pathology 2015;10(1)
Diagnostic Pathology 2015;10(1)
No comments: Submit comment
No validations: Submit validation data