HPA009292

CD109 antibody from Sigma-Aldrich
CPAMD7, DKFZp762L1111, FLJ38569
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009292
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009292, RRID:AB_1846225
Product name
Anti-CD109 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009292
Antibody type
Polyclonal
Antigen
CD109 antigen precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVSGNKRLKELSYMVVSRGQLVAVGKQNSTMFSLT
PENSWTPKACVIVYYIEDDGEIISDVLKIPVQLVF
KNKIKLYWSKVKAEPSEKVSLRISVTQPDSIVGIV
AVDKSVNLMNASNDITMENVVHEL
Storage
-20C
Provider Type Product Number
- No reagents -