HPA015113

CD109 antibody from Sigma-Aldrich
CPAMD7, DKFZp762L1111, FLJ38569
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015113
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015113, RRID:AB_1846224
Product name
Anti-CD109 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015113
Antibody type
Polyclonal
Antigen
CD109 antigen precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GPVEILTTVTESVTGISRNVSTNVFFKQHDYIIEF
FDYTTVLKPSLNFTATVKVTRADGNQLTLEERRNN
VVITVTQRNYTEYWSGSNSGNQKMEAVQKINYTVP
QSGTFKIEFPILEDSSELQLKAYFLGSKSSMA
Storage
-20C
Provider Type Product Number
- No reagents -