HPA011913

KALRN antibody from Sigma-Aldrich
ARHGEF24, DUET, duo, HAPIP, Hs.8004, Kalirin, TRAD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011913
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011913, RRID:AB_1850494
Product name
Anti-KALRN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011913
Antibody type
Polyclonal
Antigen
Kalirin RhoGEF recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLQAANADIQQAWVQDINQVLETQRDFLNALQSPI
EYQRKERSTAVMRSQPARLPQASPRPYSSVPAGSE
KPPKGSSYNPPLPPLKISTSNGSPGFEYHQPGDKF
EASK
Storage
-20C
Provider Type Product Number
- No reagents -