HPA008994

CFAP36 antibody from Atlas Antibodies
BARTL1, CCDC104, MGC15407
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008994
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008994, RRID:AB_2275429
Product name
Anti-CFAP36
Provider product page
Atlas Antibodies - HPA008994
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VHSSEAAIMNNSQGDGEHFAHPPSEVKMHFANQSI
EPLGRKVERSETSSLPQKGLKIPGLEHASIEGPIA
NLSVLGTEELRQREHYLKQKRDKLMSMRKDMRTKQ
IQNMEQKGKPTGE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -