HPA008994

CFAP36 antibody from Sigma-Aldrich
CCDC104, MGC15407
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008994
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008994, RRID:AB_2275429
Product name
Anti-CCDC104 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008994
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 104 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VHSSEAAIMNNSQGDGEHFAHPPSEVKMHFANQSI
EPLGRKVERSETSSLPQKGLKIPGLEHASIEGPIA
NLSVLGTEELRQREHYLKQKRDKLMSMRKDMRTKQ
IQNMEQKGKPTGE
Storage
-20C
Provider Type Product Number
- No reagents -