HPA013203

PCOLCE2 antibody from Sigma-Aldrich
PCPE2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013203
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013203, RRID:AB_1855084
Product name
Anti-PCOLCE2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013203
Antibody type
Polyclonal
Antigen
Procollagen C-endopeptidase enhancer 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEGKVVVLNFRFIDLESDNLCRYDFVDVYNGHANG
QRIGRFCGTFRPGALVSSGNKMMVQMISDANTAGN
GFMAMFSAAEPNERGDQYCGGLLDRPSGSFKTPNW
PDRDYPAGVTCVWHIVAPKNQLIELKFEKFDVERD
NY
Storage
-20C
Provider Type Product Number
- No reagents -