HPA009295

TTC14 antibody from Atlas Antibodies
FLJ00166, KIAA1980
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009295
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009295, RRID:AB_1858425
Product name
Anti-TTC14
Provider product page
Atlas Antibodies - HPA009295
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SNPPSLMRGLQSKNFSEDDFASALRKKQSASWALK
CVKIGVDYFKVGRHVDAMNEYNKALEIDKQNVEAL
VARGALYATKGSLNKAIEDFELALENCPTHRNARK
YLCQTLVERGGQLEEEEKFLNAESYYKKALALDET
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -