HPA009295

TTC14 antibody from Sigma-Aldrich
FLJ00166, KIAA1980
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009295
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009295, RRID:AB_1858425
Product name
Anti-TTC14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009295
Antibody type
Polyclonal
Antigen
Tetratricopeptide repeat protein 14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SNPPSLMRGLQSKNFSEDDFASALRKKQSASWALK
CVKIGVDYFKVGRHVDAMNEYNKALEIDKQNVEAL
VARGALYATKGSLNKAIEDFELALENCPTHRNARK
YLCQTLVERGGQLEEEEKFLNAESYYKKALALDET
Storage
-20C
Provider Type Product Number
- No reagents -