HPA010570

DTX3L antibody from Atlas Antibodies
BBAP, RNF143
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA010570
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA010570, RRID:AB_1847877
Product name
Anti-DTX3L
Provider product page
Atlas Antibodies - HPA010570
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ERKPLSQQERDSCISPSEPETKAEQKSNYFEVPLP
YFEYFKYICPDKINSIEKRFGVNIEIQESSPNMVC
LDFTSSRSGDLEAARESFASEFQKNTEPLKQECVS
LADSKQANKFKQELNHQFTKL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -