HPA010570

DTX3L antibody from Sigma-Aldrich
BBAP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010570
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010570, RRID:AB_1847877
Product name
Anti-DTX3L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010570
Antibody type
Polyclonal
Antigen
Protein deltex-3-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ERKPLSQQERDSCISPSEPETKAEQKSNYFEVPLP
YFEYFKYICPDKINSIEKRFGVNIEIQESSPNMVC
LDFTSSRSGDLEAARESFASEFQKNTEPLKQECVS
LADSKQANKFKQELNHQFTKL
Storage
-20C
Provider Type Product Number
- No reagents -