HPA011755

NAV2 antibody from Sigma-Aldrich
FLJ10633, FLJ11030, FLJ23707, HELAD1, KIAA1419, POMFIL2, RAINB1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011755
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011755, RRID:AB_1854319
Product name
Anti-NAV2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011755
Antibody type
Polyclonal
Antigen
Neuron navigator 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NTSSSISSYANTPASSRKNLDVQTDAEKHSQVERN
SLWSGDDVKKSDGGSDSGIKMEPGSKWRRNPSDVS
DESDKSTSGKKNPVISQTGSWRRGMTAQVGITMPR
TKASAPAGALKTPGTGKTDDAKVSEKG
Storage
-20C
Provider Type Product Number
- No reagents -