HPA011866

PCDH7 antibody from Sigma-Aldrich
BH-Pcdh, PPP1R120
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011866
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011866, RRID:AB_1855047
Product name
Anti-PCDH7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011866
Antibody type
Polyclonal
Antigen
Protocadherin-7 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGEVTFSLESGSEYLKIDNLTGELSTSERRIDREK
LPQCQMIFDENECFLDFEVSVIGPSQSWVDLFEGQ
VIVLDINDNTPTFPSPVLTLTVEENRPVGTLYLLP
T
Storage
-20C
Provider Type Product Number
- No reagents -