HPA005554

ARSA antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005554
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005554, RRID:AB_1078220
Product name
Anti-ARSA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005554
Antibody type
Polyclonal
Antigen
Arylsulfatase A precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYK
AHFFTQGSAHSDTTADPACHASSSLTAHEPPLLYD
LSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQ
LDAAVTFGPSQVARGEDPALQICCHPGCTPRPACC
HCP
Storage
-20C
Provider Type Product Number
- No reagents -