HPA008846

PARP14 antibody from Sigma-Aldrich
KIAA1268, pART8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008846
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008846, RRID:AB_1854982
Product name
Anti-PARP14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008846
Antibody type
Polyclonal
Antigen
Poly [ADP-ribose] polymerase 14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RYFLLCHSSLLDHLLTECPEIEICYDRVTQHLCLK
GPSADVYKAKCEIQEKVYTMAQKNIQVSPEIFQFL
QQVNWKEFSKCLFIAQKILALYELEGTTVLLTSCS
SEALL
Storage
-20C
Provider Type Product Number
- No reagents -