Antibody data
- Product number
- HPA012063
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA012063, RRID:AB_1854981
- Product name
- Anti-PARP14
- Provider product page
- Atlas Antibodies - HPA012063
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
AKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLK
LEDARREKKKTVDVKINHRHYTVNLNTYTATDTKG
HSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPS
DPEYNTVASKFNQTCS
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
PARP14 promotes the Warburg effect in hepatocellular carcinoma by inhibiting JNK1-dependent PKM2 phosphorylation and activation.
Iansante V, Choy PM, Fung SW, Liu Y, Chai JG, Dyson J, Del Rio A, D'Santos C, Williams R, Chokshi S, Anders RA, Bubici C, Papa S
Nature communications 2015 Aug 10;6:7882
A systematic analysis of the PARP protein family identifies new functions critical for cell physiology
Vyas S, Chesarone-Cataldo M, Todorova T, Huang Y, Chang P
Nature Communications 2013 August;4
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human placenta shows strong nuclear positivity in trophoblastic cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human uterine cervix shows strong nuclear positivity in squamous epithelial cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
- Sample type
- HUMAN