HPA012063

PARP14 antibody from Atlas Antibodies
KIAA1268, pART8
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012063
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012063, RRID:AB_1854981
Product name
Anti-PARP14
Provider product page
Atlas Antibodies - HPA012063
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AKEQESRADCISEFIEWQYNDNNTSHCFNKMTNLK
LEDARREKKKTVDVKINHRHYTVNLNTYTATDTKG
HSLSVQRLTKSKVDIPAHWSDMKQQNFCVVELLPS
DPEYNTVASKFNQTCS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -