HPA013892

PODN antibody from MilliporeSigma / Merck KGaA
MGC24995, PCAN, PODOCAN, SLRR5A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013892
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA013892, RRID:AB_1855508
Product name
Anti-PODN antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA013892
Antibody type
Polyclonal
Antigen
Podocan precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRELYLTSNRLRSRALGPRAWVDLAHLQLLDIAGN
QLTEIPEGLPESLEYLYLQNNKISAVPANAFDSTP
NLKGIFLRFNKLAVGSVVDSAFRRLKHLQVLDIEG
NLEFGDISKDRG
Storage
-20C
Provider Type Product Number
- No reagents -