HPA008162

PDE4DIP antibody from Sigma-Aldrich
CMYA2, KIAA0454, KIAA0477, MMGL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008162
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008162, RRID:AB_1855122
Product name
Anti-PDE4DIP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008162
Antibody type
Polyclonal
Antigen
Myomegalin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DVLSSNEATMQSMESLLRAKGLEVEQLSTTCQNLQ
WLKEEMETKFSRWQKEQESIIQQLQTSLHDRNKEV
EDLSATLLCKLGPGQSEIAEELCQRLQRKERMLQD
LLSDRNKQVLEHEMEIQGLLQSVSTREQESQAAA
Storage
-20C
Provider Type Product Number
- No reagents -