HPA012678

PDE4DIP antibody from Atlas Antibodies
CMYA2, KIAA0454, KIAA0477, MMGL
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012678
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012678, RRID:AB_1235135
Product name
Anti-PDE4DIP
Provider product page
Atlas Antibodies - HPA012678
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KLNLQVLLSHVLGKDVPRDGKAEFACSKCAFMLDR
IYRFDTVIARIEALSIERLQKLLLEKDRLKFCIAS
MYRKNNDDSGAEIKAGNGTVDMSVLPDARYSALLQ
EDFAYSGFECWVENEDQIQEPHSCHGSEGPGNRPR
RCRGCA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -