HPA012948

TNFSF15 antibody from Sigma-Aldrich
MGC129934, MGC129935, TL1, TL1A, VEGI, VEGI192A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012948
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012948, RRID:AB_1858024
Product name
Anti-TNFSF15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012948
Antibody type
Polyclonal
Antigen
Tumor necrosis factor ligand superfamily member 15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYP
EPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGD
KLMVNVSDISLVDYTKEDKTFFGAFLL
Storage
-20C
Provider Type Product Number
- No reagents -