Antibody data

Product number
H00008784-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008784-M03, RRID:AB_1579987
Product name
TNFRSF18 monoclonal antibody (M03), clone 2H4
Provider product page
Abnova Corporation - H00008784-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant TNFRSF18.
Antigen sequence
QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRD
YPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCP
PGQGVQSQGKFSFGFQCIDC
Isotype
IgG
Antibody clone number
2H4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -